Lineage for d1rcxr2 (1rcx R:9-147)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32786Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 32822Domain d1rcxr2: 1rcx R:9-147 [39276]
    Other proteins in same PDB: d1rcxb1, d1rcxc_, d1rcxe1, d1rcxf_, d1rcxh1, d1rcxi_, d1rcxk1, d1rcxl1, d1rcxm_, d1rcxo1, d1rcxp_, d1rcxr1, d1rcxs_, d1rcxt_, d1rcxv1, d1rcxw_

Details for d1rcxr2

PDB Entry: 1rcx (more details), 2.4 Å

PDB Description: non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate

SCOP Domain Sequences for d1rcxr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcxr2 d.58.9.1 (R:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rcxr2:

Click to download the PDB-style file with coordinates for d1rcxr2.
(The format of our PDB-style files is described here.)

Timeline for d1rcxr2: