Lineage for d6uris_ (6uri S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577424Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2577437Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins)
    automatically mapped to Pfam PF01217
  6. 2577441Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)
  7. 2577442Species Mouse (Mus musculus) [TaxId:10090] [75525] (7 PDB entries)
  8. 2577448Domain d6uris_: 6uri S: [392733]
    Other proteins in same PDB: d6uria_, d6urib_, d6urim_
    automated match to d2vgls_

Details for d6uris_

PDB Entry: 6uri (more details), 3 Å

PDB Description: hiv-1 nef in complex with the cd4 cytoplasmic domain and the ap2 clathrin adaptor complex
PDB Compounds: (S:) ap-2 complex subunit sigma

SCOPe Domain Sequences for d6uris_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uris_ d.110.4.2 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdarhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

SCOPe Domain Coordinates for d6uris_:

Click to download the PDB-style file with coordinates for d6uris_.
(The format of our PDB-style files is described here.)

Timeline for d6uris_: