![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries) |
![]() | Domain d1rcxe2: 1rcx E:9-147 [39272] Other proteins in same PDB: d1rcxb1, d1rcxc_, d1rcxe1, d1rcxf_, d1rcxh1, d1rcxi_, d1rcxk1, d1rcxl1, d1rcxm_, d1rcxo1, d1rcxp_, d1rcxr1, d1rcxs_, d1rcxt_, d1rcxv1, d1rcxw_ |
PDB Entry: 1rcx (more details), 2.4 Å
SCOP Domain Sequences for d1rcxe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcxe2 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk alralrledlripvayvkt
Timeline for d1rcxe2: