Lineage for d1rcxb2 (1rcx B:9-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952895Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)
  8. 2952936Domain d1rcxb2: 1rcx B:9-147 [39271]
    Other proteins in same PDB: d1rcxb1, d1rcxc_, d1rcxe1, d1rcxf_, d1rcxh1, d1rcxi_, d1rcxk1, d1rcxl1, d1rcxm_, d1rcxo1, d1rcxp_, d1rcxr1, d1rcxs_, d1rcxt_, d1rcxv1, d1rcxw_
    complexed with rub

Details for d1rcxb2

PDB Entry: 1rcx (more details), 2.4 Å

PDB Description: non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
PDB Compounds: (B:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcxb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOPe Domain Coordinates for d1rcxb2:

Click to download the PDB-style file with coordinates for d1rcxb2.
(The format of our PDB-style files is described here.)

Timeline for d1rcxb2: