SCOPe 2.08: Domain d6vk4d_: 6vk4 D:

Lineage for d6vk4d_ (6vk4 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein automated matches [190214] (3 species)
   not a true protein

7. Species Methylosinus trichosporium [TaxId:595536] [392646] (10 PDB entries)

8. Domain d6vk4d_: 6vk4 D: [392691]
   Other proteins in same PDB: d6vk4a_, d6vk4b_, d6vk4c_, d6vk4e_, d6vk4f_, d6vk4g_
   automated match to d1ckva_
   complexed with bez, edo, fe, fe2

Details for d6vk4d_

PDB Entry: 6vk4, 2.35 Å

PDB Description: crystal structure of methylosinus trichosporium ob3b soluble methane monooxygenase hydroxylase and regulatory component complex

PDB Compounds: (D:) Methane monooxygenase regulatory protein B

SCOPe Domain Sequences for d6vk4d_:

Sequence; same for both SEQRES and ATOM records:

>d6vk4d_ d.137.1.1 (D:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
ssahnaynagimqktgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggk
aknpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtk
ftitselmgldr

Timeline for d6vk4d_:

• d6vk4d_ first appeared in SCOPe 2.07