Lineage for d1rcov2 (1rco V:9-147)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80425Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 80426Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 80427Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 80449Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 80478Domain d1rcov2: 1rco V:9-147 [39269]
    Other proteins in same PDB: d1rcob1, d1rcoc_, d1rcoe1, d1rcof_, d1rcoh1, d1rcoi_, d1rcok1, d1rcol1, d1rcom_, d1rcoo1, d1rcop_, d1rcor1, d1rcos_, d1rcot_, d1rcov1, d1rcow_

Details for d1rcov2

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

SCOP Domain Sequences for d1rcov2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcov2 d.58.9.1 (V:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rcov2:

Click to download the PDB-style file with coordinates for d1rcov2.
(The format of our PDB-style files is described here.)

Timeline for d1rcov2: