Lineage for d6v9la_ (6v9l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866833Protein cH-p21 Ras protein [52593] (1 species)
  7. 2866834Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries)
    Uniprot Q6P716
  8. 2866865Domain d6v9la_: 6v9l A: [392651]
    Other proteins in same PDB: d6v9lb1, d6v9lb2, d6v9lc2
    automated match to d1nvvq_
    complexed with act, fmt, gnp, gol, mg, na, qtj

Details for d6v9la_

PDB Entry: 6v9l (more details), 1.7 Å

PDB Description: expanding the chemical landscape of sos1 activators using fragment based methods
PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d6v9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v9la_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d6v9la_:

Click to download the PDB-style file with coordinates for d6v9la_.
(The format of our PDB-style files is described here.)

Timeline for d6v9la_: