SCOP 1.75: Domain d1rcoh2: 1rco H:9-147

Lineage for d1rcoh2 (1rco H:9-147)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
C-terminal domain is beta/alpha barrel
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)

Domain d1rcoh2: 1rco H:9-147 [39265]
Other proteins in same PDB: d1rcob1, d1rcoc_, d1rcoe1, d1rcof_, d1rcoh1, d1rcoi_, d1rcok1, d1rcol1, d1rcom_, d1rcoo1, d1rcop_, d1rcor1, d1rcos_, d1rcot_, d1rcov1, d1rcow_

Details for d1rcoh2

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

PDB Compounds: (H:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1rcoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcoh2 d.58.9.1 (H:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rcoh2:

Click to download the PDB-style file with coordinates for d1rcoh2.
(The format of our PDB-style files is described here.)

Timeline for d1rcoh2: