Lineage for d1rcol2 (1rco L:9-147)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32786Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 32812Domain d1rcol2: 1rco L:9-147 [39262]
    Other proteins in same PDB: d1rcob1, d1rcoc_, d1rcoe1, d1rcof_, d1rcoh1, d1rcoi_, d1rcok1, d1rcol1, d1rcom_, d1rcoo1, d1rcop_, d1rcor1, d1rcos_, d1rcot_, d1rcov1, d1rcow_

Details for d1rcol2

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

SCOP Domain Sequences for d1rcol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcol2 d.58.9.1 (L:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rcol2:

Click to download the PDB-style file with coordinates for d1rcol2.
(The format of our PDB-style files is described here.)

Timeline for d1rcol2: