SCOPe 2.08: Domain d6vcdc2: 6vcd C:85-160

Lineage for d6vcdc2 (6vcd C:85-160)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d6vcdc2: 6vcd C:85-160 [392619]
   Other proteins in same PDB: d6vcdc1
   automated match to d5k35b2
   complexed with fes

Details for d6vcdc2

PDB Entry: 6vcd, 3 Å

PDB Description: cryo-em structure of irp2-fbxl5-skp1 complex

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6vcdc2:

Sequence; same for both SEQRES and ATOM records:

>d6vcdc2 a.157.1.1 (C:85-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc

Timeline for d6vcdc2:

• d6vcdc2 first appeared in SCOPe 2.07