Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
Domain d6v7ze_: 6v7z E: [392617] Other proteins in same PDB: d6v7za1, d6v7zb1, d6v7zb2, d6v7zc1, d6v7zd_ automated match to d4nc2b_ complexed with agh, bgc, cl, na, nag, peg, so4 |
PDB Entry: 6v7z (more details), 2.75 Å
SCOPe Domain Sequences for d6v7ze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v7ze_ b.1.1.0 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesggglvqaggslrlscaasgsifsinamgwyrqapgkqrdflavisssgstnya dsvkgrftisrdnakntaylqmnslkvedtavyycaahvagfdeynywgqgtqvtvs
Timeline for d6v7ze_: