Lineage for d6v7ze_ (6v7z E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369733Domain d6v7ze_: 6v7z E: [392617]
    Other proteins in same PDB: d6v7za1, d6v7zb1, d6v7zb2, d6v7zc1, d6v7zd_
    automated match to d4nc2b_
    complexed with agh, bgc, cl, na, nag, peg, so4

Details for d6v7ze_

PDB Entry: 6v7z (more details), 2.75 Å

PDB Description: human cd1d presenting alpha-galactosylceramide in complex with vhh nanobody 1d22
PDB Compounds: (E:) Nanobody VHH ID22

SCOPe Domain Sequences for d6v7ze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v7ze_ b.1.1.0 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgsifsinamgwyrqapgkqrdflavisssgstnya
dsvkgrftisrdnakntaylqmnslkvedtavyycaahvagfdeynywgqgtqvtvs

SCOPe Domain Coordinates for d6v7ze_:

Click to download the PDB-style file with coordinates for d6v7ze_.
(The format of our PDB-style files is described here.)

Timeline for d6v7ze_: