Lineage for d1rxoh2 (1rxo H:9-147)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32786Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 32805Domain d1rxoh2: 1rxo H:9-147 [39260]
    Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_

Details for d1rxoh2

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxoh2 d.58.9.1 (H:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rxoh2:

Click to download the PDB-style file with coordinates for d1rxoh2.
(The format of our PDB-style files is described here.)

Timeline for d1rxoh2: