Lineage for d1rxoe2 (1rxo E:9-147)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) 
C-terminal domain is beta/alpha barrelFamily d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries) 
Domain d1rxoe2: 1rxo E:9-147 [39259]
Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_
complexed with ca, rub
Details for d1rxoe2
PDB Entry: 1rxo (more details), 2.2 Å
PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium
PDB Compounds: (E:) ribulose bisphosphate carboxylase/oxygenaseSCOPe Domain Sequences for d1rxoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxoe2 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt
SCOPe Domain Coordinates for d1rxoe2:
Click to download the PDB-style file with coordinates for d1rxoe2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rxoe2:
View in 3D
