Lineage for d1rxob2 (1rxo B:9-147)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504757Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 504758Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 504759Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 504816Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 504834Domain d1rxob2: 1rxo B:9-147 [39258]
    Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_

Details for d1rxob2

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxob2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rxob2:

Click to download the PDB-style file with coordinates for d1rxob2.
(The format of our PDB-style files is described here.)

Timeline for d1rxob2: