Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries) |
Domain d1rxob2: 1rxo B:9-147 [39258] Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_ |
PDB Entry: 1rxo (more details), 2.2 Å
SCOP Domain Sequences for d1rxob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxob2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk alralrledlripvayvkt
Timeline for d1rxob2: