Lineage for d6v4oe1 (6v4o E:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355609Domain d6v4oe1: 6v4o E:1-106 [392573]
    Other proteins in same PDB: d6v4ob2, d6v4oe2, d6v4og2, d6v4oi1, d6v4oi2, d6v4ol2, d6v4om1, d6v4om2, d6v4on1, d6v4on2, d6v4ow1, d6v4ow2
    automated match to d1dn0a1
    complexed with bma, ca

Details for d6v4oe1

PDB Entry: 6v4o (more details), 2.8 Å

PDB Description: structure of human 2e01 fab in complex with influenza virus neuraminidase from b/phuket/3073/2013
PDB Compounds: (E:) antibody fab light chain

SCOPe Domain Sequences for d6v4oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v4oe1 b.1.1.1 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslfpgeratlscrasqsagskslawyqhkvgqpprllingassratgip
drfsgsgsgpdfnltisrlepedfavyycqrygtslvtfgggtkvei

SCOPe Domain Coordinates for d6v4oe1:

Click to download the PDB-style file with coordinates for d6v4oe1.
(The format of our PDB-style files is described here.)

Timeline for d6v4oe1: