![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1570 PDB entries) |
![]() | Domain d6v7za2: 6v7z A:184-278 [392572] Other proteins in same PDB: d6v7za1, d6v7zb1, d6v7zb2, d6v7zc1, d6v7zd_ automated match to d1zt4c1 complexed with agh, bgc, cl, na, nag, peg, so4 |
PDB Entry: 6v7z (more details), 2.75 Å
SCOPe Domain Sequences for d6v7za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v7za2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw ylratldvvageaaglscrvkhsslegqdivlywg
Timeline for d6v7za2: