Lineage for d6v7za1 (6v7z A:5-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937558Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
  8. 2937567Domain d6v7za1: 6v7z A:5-183 [392571]
    Other proteins in same PDB: d6v7za2, d6v7za3, d6v7zb1, d6v7zb2, d6v7zc2, d6v7zd_, d6v7ze_, d6v7zf_
    automated match to d1zt4c2
    complexed with agh, bgc, cl, na, nag, peg, so4

Details for d6v7za1

PDB Entry: 6v7z (more details), 2.75 Å

PDB Description: human cd1d presenting alpha-galactosylceramide in complex with vhh nanobody 1d22
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d6v7za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v7za1 d.19.1.1 (A:5-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
qrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwe
tlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdil
sfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d6v7za1:

Click to download the PDB-style file with coordinates for d6v7za1.
(The format of our PDB-style files is described here.)

Timeline for d6v7za1: