Lineage for d6v7zc2 (6v7z C:184-277)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (28 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1570 PDB entries)
  8. 3092501Domain d6v7zc2: 6v7z C:184-277 [392563]
    Other proteins in same PDB: d6v7za1, d6v7zb1, d6v7zb2, d6v7zc1, d6v7zd_
    automated match to d1zt4c1
    complexed with agh, bgc, cl, na, nag, peg, so4

Details for d6v7zc2

PDB Entry: 6v7z (more details), 2.75 Å

PDB Description: human cd1d presenting alpha-galactosylceramide in complex with vhh nanobody 1d22
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d6v7zc2:

Sequence, based on SEQRES records: (download)

>d6v7zc2 b.1.1.0 (C:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Sequence, based on observed residues (ATOM records): (download)

>d6v7zc2 b.1.1.0 (C:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpsplllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetwylra
tldvaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d6v7zc2:

Click to download the PDB-style file with coordinates for d6v7zc2.
(The format of our PDB-style files is described here.)

Timeline for d6v7zc2:

  • d6v7zc2 is new in SCOPe 2.07-stable