Lineage for d1aa1b2 (1aa1 B:21-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952895Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)
  8. 2952908Domain d1aa1b2: 1aa1 B:21-147 [39254]
    Other proteins in same PDB: d1aa1b1, d1aa1c_, d1aa1e1, d1aa1f_, d1aa1h1, d1aa1i_, d1aa1l1, d1aa1s_
    complexed with 3pg, mg

Details for d1aa1b2

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate
PDB Compounds: (B:) ribulose bisphosphate carboxylase (large chain)

SCOPe Domain Sequences for d1aa1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa1b2 d.58.9.1 (B:21-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
pvayvkt

SCOPe Domain Coordinates for d1aa1b2:

Click to download the PDB-style file with coordinates for d1aa1b2.
(The format of our PDB-style files is described here.)

Timeline for d1aa1b2: