Lineage for d6uynb_ (6uyn B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646598Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)
  8. 2646608Domain d6uynb_: 6uyn B: [392538]
    Other proteins in same PDB: d6uyna_, d6uynl1
    automated match to d5bnyf_
    complexed with cl, nag

Details for d6uynb_

PDB Entry: 6uyn (more details), 2.85 Å

PDB Description: crystal structure of influenza a virus hemagglutinin from a/ohio/09/2015 bound to the stalk-binding cr6261 antibody fab
PDB Compounds: (B:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6uynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uynb_ h.3.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadlkstqnaidgitnkvnsviekmn
tqftavgkefshlerrienlnkkvddgfidiwtynaellvllenertldyhdsnvktlye
kvrsqlknnakeigngcfefyhkcddtcmesvkngtydypkyseeak

SCOPe Domain Coordinates for d6uynb_:

Click to download the PDB-style file with coordinates for d6uynb_.
(The format of our PDB-style files is described here.)

Timeline for d6uynb_: