Lineage for d1aa1l2 (1aa1 L:21-147)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329311Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 329312Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 329313Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 329370Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 329386Domain d1aa1l2: 1aa1 L:21-147 [39253]
    Other proteins in same PDB: d1aa1b1, d1aa1c_, d1aa1e1, d1aa1f_, d1aa1h1, d1aa1i_, d1aa1l1, d1aa1s_

Details for d1aa1l2

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

SCOP Domain Sequences for d1aa1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa1l2 d.58.9.1 (L:21-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
pvayvkt

SCOP Domain Coordinates for d1aa1l2:

Click to download the PDB-style file with coordinates for d1aa1l2.
(The format of our PDB-style files is described here.)

Timeline for d1aa1l2: