Lineage for d6uyna_ (6uyn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386336Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2386395Domain d6uyna_: 6uyn A: [392519]
    Other proteins in same PDB: d6uynb_, d6uynl1
    automated match to d4we4a_
    complexed with cl, nag

Details for d6uyna_

PDB Entry: 6uyn (more details), 2.85 Å

PDB Description: crystal structure of influenza a virus hemagglutinin from a/ohio/09/2015 bound to the stalk-binding cr6261 antibody fab
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6uyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uyna_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dadkicigyhannstdtvdtvleknvtvthsvnllenkhngklcklrgvaplhlgkcnia
gwllgnpeceslatasswsyivetsssnngtcypgdfinyeelreqlssvssfekfeifp
ktsswpnhetnkgvtaacphagtnsfyknliwlvkkensypkinisytnnrgkevlvlwa
ihhpptstdqqslyqnansyvfvgssrysrkfepeiatrpkvrgqagrmnyywtlvepgd
kitfeatgnlvvpryafalkrnsgsgiiisetpvhdcdttcqtpngaintslpfqnihpv
tigecpkyvkstklrmatglrnipsi

SCOPe Domain Coordinates for d6uyna_:

Click to download the PDB-style file with coordinates for d6uyna_.
(The format of our PDB-style files is described here.)

Timeline for d6uyna_: