SCOPe 2.08: Domain d6uzv7_: 6uzv 7:

Lineage for d6uzv7_ (6uzv 7:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)

6. Protein automated matches [236565] (3 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [347611] (2 PDB entries)

8. Domain d6uzv7_: 6uzv 7: [392518]
   Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv8_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvk_, d6uzvl_
   automated match to d4kt0j_
   complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv7_

PDB Entry: 6uzv, 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex

PDB Compounds: (7:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6uzv7_:

Sequence; same for both SEQRES and ATOM records:

>d6uzv7_ f.23.18.1 (7:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdglksflstapvmimalltftagiliefnrfypdllfh

Timeline for d6uzv7_:

• d6uzv7_ first appeared in SCOPe 2.07