Lineage for d6uzvl_ (6uzv l:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027934Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 3027938Protein automated matches [347525] (2 species)
    not a true protein
  7. 3027939Species Synechocystis sp. [TaxId:1111708] [347526] (2 PDB entries)
  8. 3027943Domain d6uzvl_: 6uzv l: [392510]
    Other proteins in same PDB: d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzv8_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvk_
    automated match to d1jb0l_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzvl_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (l:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6uzvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzvl_ f.31.1.1 (l:) automated matches {Synechocystis sp. [TaxId: 1111708]}
nqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyfligp
wtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgwsqfa
agffvggmggafvayfllenlsvvdgifrglfn

SCOPe Domain Coordinates for d6uzvl_:

Click to download the PDB-style file with coordinates for d6uzvl_.
(The format of our PDB-style files is described here.)

Timeline for d6uzvl_: