Lineage for d1rboe2 (1rbo E:9-147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724752Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 724753Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 724754Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 724864Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 724874Domain d1rboe2: 1rbo E:9-147 [39251]
    Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_

Details for d1rboe2

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate
PDB Compounds: (E:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1rboe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rboe2 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rboe2:

Click to download the PDB-style file with coordinates for d1rboe2.
(The format of our PDB-style files is described here.)

Timeline for d1rboe2: