Lineage for d1rbob2 (1rbo B:9-147)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412559Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 412560Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 412561Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 412618Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 412628Domain d1rbob2: 1rbo B:9-147 [39250]
    Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_

Details for d1rbob2

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

SCOP Domain Sequences for d1rbob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbob2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rbob2:

Click to download the PDB-style file with coordinates for d1rbob2.
(The format of our PDB-style files is described here.)

Timeline for d1rbob2: