Lineage for d6upwd1 (6upw D:5-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491258Species Chicken (Gallus gallus) [TaxId:9031] [82437] (2 PDB entries)
    sequence identical to the rabbit actin
  8. 2491269Domain d6upwd1: 6upw D:5-146 [392469]
    automated match to d1qz5a1
    complexed with adp, mg

Details for d6upwd1

PDB Entry: 6upw (more details), 2.9 Å

PDB Description: metavinculin abd-f-actin complex
PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6upwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6upwd1 c.55.1.1 (D:5-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d6upwd1:

Click to download the PDB-style file with coordinates for d6upwd1.
(The format of our PDB-style files is described here.)

Timeline for d6upwd1: