SCOP 1.55: Domain d8rucc2: 8ruc C:9-147

Lineage for d8rucc2 (8ruc C:9-147)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)

8. Domain d8rucc2: 8ruc C:9-147 [39246]
   Other proteins in same PDB: d8ruca1, d8rucc1, d8ruce1, d8rucg1, d8ruci_, d8rucj_, d8ruck_, d8rucl_

Details for d8rucc2

PDB Entry: 8ruc, 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate

SCOP Domain Sequences for d8rucc2:

Sequence; same for both SEQRES and ATOM records:

>d8rucc2 d.58.9.1 (C:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d8rucc2:

• d8rucc2 appears in SCOP 1.57
  
• d8rucc2 appears in the current release, SCOPe 2.08