SCOPe 2.05: Domain d8ruca2: 8ruc A:9-147

Lineage for d8ruca2 (8ruc A:9-147)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (10 PDB entries)

8. Domain d8ruca2: 8ruc A:9-147 [39245]
   Other proteins in same PDB: d8ruca1, d8rucc1, d8ruce1, d8rucg1, d8ruci_, d8rucj_, d8ruck_, d8rucl_
   complexed with cap, mg

Details for d8ruca2

PDB Entry: 8ruc, 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate

PDB Compounds: (A:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d8ruca2:

Sequence; same for both SEQRES and ATOM records:

>d8ruca2 d.58.9.1 (A:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d8ruca2:

• d8ruca2 first appeared (with stable ids) in SCOP 1.55
  
• d8ruca2 appears in SCOPe 2.04
  
• d8ruca2 appears in SCOPe 2.06
  
• d8ruca2 appears in the current release, SCOPe 2.08