SCOPe 2.07: Domain d6upwe2: 6upw E:147-374

Lineage for d6upwe2 (6upw E:147-374)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [82437] (2 PDB entries)
   sequence identical to the rabbit actin

8. Domain d6upwe2: 6upw E:147-374 [392406]
   automated match to d1qz5a2
   complexed with adp, mg

Details for d6upwe2

PDB Entry: 6upw, 2.9 Å

PDB Description: metavinculin abd-f-actin complex

PDB Compounds: (E:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6upwe2:

Sequence; same for both SEQRES and ATOM records:

>d6upwe2 c.55.1.1 (E:147-374) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

Timeline for d6upwe2:

• d6upwe2 is new in SCOPe 2.07-stable
  
• d6upwe2 appears in the current release, SCOPe 2.08