Lineage for d4rubc2 (4rub C:9-147)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32827Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)
  8. 32835Domain d4rubc2: 4rub C:9-147 [39239]
    Other proteins in same PDB: d4ruba1, d4rubb1, d4rubc1, d4rubd1, d4rubs_, d4rubt_, d4rubu_, d4rubv_

Details for d4rubc2

PDB Entry: 4rub (more details), 2.7 Å

PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state

SCOP Domain Sequences for d4rubc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rubc2 d.58.9.1 (C:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
alralrledlrippayvkt

SCOP Domain Coordinates for d4rubc2:

Click to download the PDB-style file with coordinates for d4rubc2.
(The format of our PDB-style files is described here.)

Timeline for d4rubc2: