SCOPe 2.07: Domain d6us0b_: 6us0 B:

Lineage for d6us0b_ (6us0 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)
   contains one classic and one pseudo HhH motifs
   automatically mapped to Pfam PF02961

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (23 PDB entries)

8. Domain d6us0b_: 6us0 B: [392385]
   automated match to d1ci4a_
   complexed with eoh

Details for d6us0b_

PDB Entry: 6us0, 1.65 Å

PDB Description: barrier-to-autointegration factor soaked in r,s,r-bisfuranol (rsr): 1 of 14 in mscs set

PDB Compounds: (B:) barrier-to-autointegration factor

SCOPe Domain Sequences for d6us0b_:

Sequence; same for both SEQRES and ATOM records:

>d6us0b_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
wlkdtcganakqsrdcfgclrewcdafl

Timeline for d6us0b_:

• d6us0b_ is new in SCOPe 2.07-stable
  
• d6us0b_ appears in the current release, SCOPe 2.08