| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species) |
| Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries) |
| Domain d4rubb2: 4rub B:9-147 [39238] Other proteins in same PDB: d4ruba1, d4rubb1, d4rubc1, d4rubd1, d4rubs_, d4rubt_, d4rubu_, d4rubv_ |
PDB Entry: 4rub (more details), 2.7 Å
SCOP Domain Sequences for d4rubb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rubb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
alralrledlrippayvkt
Timeline for d4rubb2: