SCOPe 2.08: Domain d4rubb2: 4rub B:9-147

Lineage for d4rubb2 (4rub B:9-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)

8. Domain d4rubb2: 4rub B:9-147 [39238]
   Other proteins in same PDB: d4ruba1, d4rubb1, d4rubc1, d4rubd1, d4rubs_, d4rubt_, d4rubu_, d4rubv_
   complexed with cap, fmt, mg

Details for d4rubb2

PDB Entry: 4rub, 2.7 Å

PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state

PDB Compounds: (B:) ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)

SCOPe Domain Sequences for d4rubb2:

Sequence; same for both SEQRES and ATOM records:

>d4rubb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
alralrledlrippayvkt

Timeline for d4rubb2:

• d4rubb2 first appeared (with stable ids) in SCOP 1.55
  
• d4rubb2 appears in SCOPe 2.07