Lineage for d6uogc_ (6uog C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911318Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2911319Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2911320Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins)
    automatically mapped to Pfam PF00710
  6. 2911321Protein Asparaginase type II [53776] (5 species)
  7. 2911374Species Escherichia coli [TaxId:562] [53777] (42 PDB entries)
  8. 2911474Domain d6uogc_: 6uog C: [392371]
    automated match to d1nnsa_
    complexed with asp

Details for d6uogc_

PDB Entry: 6uog (more details), 2.29 Å

PDB Description: asparaginase ii from escherichia coli
PDB Compounds: (C:) L-asparaginase 2

SCOPe Domain Sequences for d6uogc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uogc_ c.88.1.1 (C:) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
karvllqlaltqtkdpqqiqqifnqy

SCOPe Domain Coordinates for d6uogc_:

Click to download the PDB-style file with coordinates for d6uogc_.
(The format of our PDB-style files is described here.)

Timeline for d6uogc_: