Lineage for d6uria_ (6uri A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338911Family a.118.1.10: Clathrin adaptor core protein [74771] (3 proteins)
    automatically mapped to Pfam PF01602
  6. 2338912Protein Adaptin alpha C subunit N-terminal fragment [74772] (1 species)
  7. 2338913Species Mouse (Mus musculus) [TaxId:10090] [74773] (3 PDB entries)
  8. 2338915Domain d6uria_: 6uri A: [392363]
    Other proteins in same PDB: d6urib_, d6urim_, d6uris_
    automated match to d2vgla_

Details for d6uria_

PDB Entry: 6uri (more details), 3 Å

PDB Description: hiv-1 nef in complex with the cd4 cytoplasmic domain and the ap2 clathrin adaptor complex
PDB Compounds: (A:) AP-2 complex subunit alpha

SCOPe Domain Sequences for d6uria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uria_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
gmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvckllfifll
ghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndlasrnptfm
glalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtspdlvpmgdw
tsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsastdlqdyt
yyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkvqhsnakna
vlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlassefsheavkt
hietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysireeivlkv
ailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaaktvfealq
apachenlvkvggyilgefgnliagdprsspliqfnllhskfhlcsvptralllstyikf
vnlfpevkatiqdvlrsdsqlknadvelqqraveylrlstvastdilatvleemppfper
essilaklkkk

SCOPe Domain Coordinates for d6uria_:

Click to download the PDB-style file with coordinates for d6uria_.
(The format of our PDB-style files is described here.)

Timeline for d6uria_: