Lineage for d1rlcl2 (1rlc L:22-147)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329311Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 329312Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 329313Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 329411Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)
  8. 329416Domain d1rlcl2: 1rlc L:22-147 [39236]
    Other proteins in same PDB: d1rlcl1, d1rlcs_
    complexed with cap

Details for d1rlcl2

PDB Entry: 1rlc (more details), 2.7 Å

PDB Description: crystal structure of the unactivated ribulose 1, 5-bisphosphate carboxylase(slash)oxygenase complexed with a transition state analog, 2-carboxy-d-arabinitol 1,5-bisphosphate

SCOP Domain Sequences for d1rlcl2:

Sequence, based on SEQRES records: (download)

>d1rlcl2 d.58.9.1 (L:22-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
payvkt

Sequence, based on observed residues (ATOM records): (download)

>d1rlcl2 d.58.9.1 (L:22-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
t

SCOP Domain Coordinates for d1rlcl2:

Click to download the PDB-style file with coordinates for d1rlcl2.
(The format of our PDB-style files is described here.)

Timeline for d1rlcl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlcl1
View in 3D
Domains from other chains:
(mouse over for more information)
d1rlcs_