Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein automated matches [190345] (4 species) not a true protein |
Species Lymantria dispar [TaxId:13123] [392351] (1 PDB entry) |
Domain d6um9a_: 6um9 A: [392352] automated match to d2kpha_ |
PDB Entry: 6um9 (more details)
SCOPe Domain Sequences for d6um9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6um9a_ a.39.2.1 (A:) automated matches {Lymantria dispar [TaxId: 13123]} skevmkqmtinfakpmeackqelnvpdavmqdffnfwkegyqitnreagcvilclakkle lldqdmnlhhgkamefamkhgadeamakqlldikhscekvitivaddpcqtmlnlamcfk aeihkldwaptldvavgelladt
Timeline for d6um9a_: