Lineage for d6um9a_ (6um9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711909Protein automated matches [190345] (4 species)
    not a true protein
  7. 2711924Species Lymantria dispar [TaxId:13123] [392351] (1 PDB entry)
  8. 2711925Domain d6um9a_: 6um9 A: [392352]
    automated match to d2kpha_

Details for d6um9a_

PDB Entry: 6um9 (more details)

PDB Description: gypsy moth pheromone-binding protein 1 (ldispbp1) nmr structure at ph 4.5
PDB Compounds: (A:) Pheromone binding protein 1

SCOPe Domain Sequences for d6um9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6um9a_ a.39.2.1 (A:) automated matches {Lymantria dispar [TaxId: 13123]}
skevmkqmtinfakpmeackqelnvpdavmqdffnfwkegyqitnreagcvilclakkle
lldqdmnlhhgkamefamkhgadeamakqlldikhscekvitivaddpcqtmlnlamcfk
aeihkldwaptldvavgelladt

SCOPe Domain Coordinates for d6um9a_:

Click to download the PDB-style file with coordinates for d6um9a_.
(The format of our PDB-style files is described here.)

Timeline for d6um9a_: