Lineage for d1rldb2 (1rld B:22-147)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412559Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 412560Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 412561Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 412659Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)
  8. 412663Domain d1rldb2: 1rld B:22-147 [39235]
    Other proteins in same PDB: d1rlda1, d1rldb1, d1rlds_, d1rldt_

Details for d1rldb2

PDB Entry: 1rld (more details), 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase

SCOP Domain Sequences for d1rldb2:

Sequence, based on SEQRES records: (download)

>d1rldb2 d.58.9.1 (B:22-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
payvkt

Sequence, based on observed residues (ATOM records): (download)

>d1rldb2 d.58.9.1 (B:22-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
t

SCOP Domain Coordinates for d1rldb2:

Click to download the PDB-style file with coordinates for d1rldb2.
(The format of our PDB-style files is described here.)

Timeline for d1rldb2: