SCOP 1.55: Domain d1ej7l2: 1ej7 L:18-147

Lineage for d1ej7l2 (1ej7 L:18-147)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)

7. Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)

8. Domain d1ej7l2: 1ej7 L:18-147 [39233]
   Other proteins in same PDB: d1ej7l1, d1ej7s_

Details for d1ej7l2

PDB Entry: 1ej7, 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions

SCOP Domain Sequences for d1ej7l2:

Sequence; same for both SEQRES and ATOM records:

>d1ej7l2 d.58.9.1 (L:18-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
kdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsl
drykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrled
lrippayvkt

Timeline for d1ej7l2:

• d1ej7l2 appears in SCOP 1.57
  
• d1ej7l2 appears in the current release, SCOPe 2.08