![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species) |
![]() | Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries) |
![]() | Domain d1ej7l2: 1ej7 L:18-147 [39233] Other proteins in same PDB: d1ej7l1, d1ej7s_ |
PDB Entry: 1ej7 (more details), 2.45 Å
SCOP Domain Sequences for d1ej7l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej7l2 d.58.9.1 (L:18-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun} kdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsl drykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrled lrippayvkt
Timeline for d1ej7l2: