Lineage for d6ufva_ (6ufv A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377160Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2377161Protein automated matches [191113] (12 species)
    not a true protein
  7. 2377171Species Bacillus subtilis [TaxId:224308] [392320] (2 PDB entries)
  8. 2377172Domain d6ufva_: 6ufv A: [392321]
    automated match to d1nbca_
    complexed with peg

Details for d6ufva_

PDB Entry: 6ufv (more details), 1.06 Å

PDB Description: crystal structure of the cbm3 from bacillus subtilis at 1.06 angstrom resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d6ufva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ufva_ b.2.2.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
masisvqyragdgsmnsnqirpqlqiknngnttvdlkdvtarywykaknkgqnfdcdyaq
igcgnvthkfvtlhkpkqgadtylelgfkngtlapgastgniqlrlhnddwsnyaqsgdy
sffksntfkttkkitlydqgkliwgtepn

SCOPe Domain Coordinates for d6ufva_:

Click to download the PDB-style file with coordinates for d6ufva_.
(The format of our PDB-style files is described here.)

Timeline for d6ufva_: