Class b: All beta proteins [48724] (178 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries) |
Domain d6udcd_: 6udc D: [392310] automated match to d4ekva_ complexed with btn, dv7 |
PDB Entry: 6udc (more details), 2.1 Å
SCOPe Domain Sequences for d6udcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6udcd_ b.61.1.1 (D:) automated matches {Streptomyces avidinii [TaxId: 1895]} agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg wtvawknnyrnahsattwsgqyvggaearintqwlxtsgtteanawkstlvghdtftkvk ps
Timeline for d6udcd_: