Lineage for d1vhib_ (1vhi B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32738Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 32739Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 32740Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (1 species)
  7. 32741Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries)
  8. 32745Domain d1vhib_: 1vhi B: [39231]

Details for d1vhib_

PDB Entry: 1vhi (more details), 2.5 Å

PDB Description: epstein barr virus nuclear antigen-1 dna-binding domain, residues 470-607

SCOP Domain Sequences for d1vhib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhib_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus}
pkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltp
lsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirv
tvcsfddgvdlp

SCOP Domain Coordinates for d1vhib_:

Click to download the PDB-style file with coordinates for d1vhib_.
(The format of our PDB-style files is described here.)

Timeline for d1vhib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhia_