Lineage for d1vhia_ (1vhi A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559568Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2559569Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2559570Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species)
    DNA-binding mode differs from that of E2 protein
  7. 2559574Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries)
  8. 2559577Domain d1vhia_: 1vhi A: [39230]

Details for d1vhia_

PDB Entry: 1vhi (more details), 2.5 Å

PDB Description: epstein barr virus nuclear antigen-1 dna-binding domain, residues 470-607
PDB Compounds: (A:) epstein barr virus nuclear antigen-1

SCOPe Domain Sequences for d1vhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhia_ d.58.8.1 (A:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus [TaxId: 10376]}
mgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalai
pqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpa
ptcnirvtvcsfddgvdlp

SCOPe Domain Coordinates for d1vhia_:

Click to download the PDB-style file with coordinates for d1vhia_.
(The format of our PDB-style files is described here.)

Timeline for d1vhia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhib_