![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species) DNA-binding mode differs from that of E2 protein |
![]() | Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries) |
![]() | Domain d1b3tb_: 1b3t B: [39229] protein/DNA complex |
PDB Entry: 1b3t (more details), 2.2 Å
SCOPe Domain Sequences for d1b3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3tb_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus [TaxId: 10376]} kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik dlvmtkpaptcnirvtvcsfddgvdlp
Timeline for d1b3tb_: