SCOPe 2.06: Domain d1b3tb_: 1b3t B:

Lineage for d1b3tb_ (1b3t B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (1 species)
   DNA-binding mode differs from that of E2 protein

7. Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries)

8. Domain d1b3tb_: 1b3t B: [39229]
   protein/DNA complex

Details for d1b3tb_

PDB Entry: 1b3t, 2.2 Å

PDB Description: ebna-1 nuclear protein/dna complex

PDB Compounds: (B:) protein (nuclear protein ebna1)

SCOPe Domain Sequences for d1b3tb_:

Sequence; same for both SEQRES and ATOM records:

>d1b3tb_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus [TaxId: 10376]}
kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
dlvmtkpaptcnirvtvcsfddgvdlp

Timeline for d1b3tb_:

• d1b3tb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b3tb_ appears in SCOPe 2.05
  
• d1b3tb_ appears in SCOPe 2.07
  
• d1b3tb_ appears in the current release, SCOPe 2.08