Lineage for d1b3tb_ (1b3t B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) 
Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins) 
Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (1 species) Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries) 
Domain d1b3tb_: 1b3t B: [39229]
Details for d1b3tb_
PDB Entry: 1b3t (more details), 2.2 Å
PDB Description: ebna-1 nuclear protein/dna complex
SCOP Domain Sequences for d1b3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3tb_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus}
kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
dlvmtkpaptcnirvtvcsfddgvdlp
SCOP Domain Coordinates for d1b3tb_:
Click to download the PDB-style file with coordinates for d1b3tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b3tb_:
- d1b3tb_ appears in SCOP 1.57
- d1b3tb_ appears in the current release, SCOPe 2.08
View in 3D
