Lineage for d1b3ta_ (1b3t A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80396Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 80397Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 80398Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (1 species)
  7. 80399Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries)
  8. 80400Domain d1b3ta_: 1b3t A: [39228]

Details for d1b3ta_

PDB Entry: 1b3t (more details), 2.2 Å

PDB Description: ebna-1 nuclear protein/dna complex

SCOP Domain Sequences for d1b3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ta_ d.58.8.1 (A:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus}
kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
dlvmtkpaptcnirvtvcsfddgvdlp

SCOP Domain Coordinates for d1b3ta_:

Click to download the PDB-style file with coordinates for d1b3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1b3ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b3tb_