Lineage for d6u46a_ (6u46 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634423Protein Insulin [56996] (3 species)
  7. 2634433Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 2634524Domain d6u46a_: 6u46 A: [392276]
    automated match to d5wbta_

Details for d6u46a_

PDB Entry: 6u46 (more details)

PDB Description: solution structure of a heat-resistant long-acting insulin analog
PDB Compounds: (A:) insulin

SCOPe Domain Sequences for d6u46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u46a_ g.1.1.1 (A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytprteegsrrsrgiveqccrsicslyqlenycg

SCOPe Domain Coordinates for d6u46a_:

Click to download the PDB-style file with coordinates for d6u46a_.
(The format of our PDB-style files is described here.)

Timeline for d6u46a_: